PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun001401
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 372aa    MW: 41224.5 Da    PI: 5.6709
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-23941PU_refplantGDBView CDS
gnl|UG|Vun#S45962518PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.21.2e-17193247256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Vun001401 193 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 247
                788899***********************************************98 PP

2HD-ZIP_I/II128.13.7e-41193282191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
    Vun001401 193 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-AL 282
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.1E-429147IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.1E-18173247IPR009057Homeodomain-like
SuperFamilySSF466897.27E-19179250IPR009057Homeodomain-like
PROSITE profilePS5007117.103189249IPR001356Homeobox domain
SMARTSM003891.9E-15191253IPR001356Homeobox domain
CDDcd000869.90E-16193250No hitNo description
PfamPF000463.9E-15193247IPR001356Homeobox domain
PROSITE patternPS000270224247IPR017970Homeobox, conserved site
CDDcd146860.00892242281No hitNo description
PfamPF021836.1E-11249283IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.6E-25249292IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MELGLSLGDS SRPLLGFMEK PREASNQLGL GFSTTLSIGP VITAQKDHQD EQEDFEEEEE  60
QETKPKKSNN THTTEDPSEP NPVLHQLDLL PQLYLPWHPP SENGSLSSEL GGSSRGLDVN  120
AQPPQAEDEA EEVAALSSSP NSAASSFQMD LCIYNRGGSF YKRNYEGEAY DQRASSRASD  180
EDDNNGSGGG NARKKLRLSK EQSAFLEESF KEHNTLNPKQ KLALAKQLNL RPRQVEVWFQ  240
NRRARTKLKQ TEVDCEYLKR CCETLTEENR RLHKELQELR ALKSSNPFYM QLPATTLTMC  300
PSCERVATNS TSTCSSLSAP NATMNANSGA MAIVKSSASN NDSPSKPIGF PFGKPRFHPF  360
VHTSQQHQSP SS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1241249RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007149086.10.0hypothetical protein PHAVU_005G040000g
SwissprotQ67UE24e-89HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLA0A0S3SJN30.0A0A0S3SJN3_PHAAN; Uncharacterized protein
STRINGGLYMA15G42380.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-61homeobox from Arabidopsis thaliana